Protein Info for AZOBR_RS07020 in Azospirillum brasilense Sp245

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 TIGR03440: ergothioneine biosynthesis protein EgtB" amino acids 11 to 424 (414 residues), 568 bits, see alignment E=8.1e-175 PF12867: DinB_2" amino acids 14 to 136 (123 residues), 47.2 bits, see alignment E=3.3e-16 PF03781: FGE-sulfatase" amino acids 179 to 424 (246 residues), 125.9 bits, see alignment E=2.3e-40

Best Hits

KEGG orthology group: None (inferred from 62% identity to rso:RSc1789)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AKR4 at UniProt or InterPro

Protein Sequence (427 amino acids)

>AZOBR_RS07020 hypothetical protein (Azospirillum brasilense Sp245)
MLKTAAKAGGLADRFRRVRATSAELAVGLSPEDQVVQSMPDASPVKWHLAHTTWFFETFL
LSPNLPGYRPFDPAFGYLFNSYYEAVGARHPRPRRGLVTRPGVAEVAAYRDHVDAAMLTL
LERGDAERLAPLVTLGLAHEEQHQELILMDLLHLFSCNPVAPAYRPYRPALRGPAHEGRW
IAVDGGIVAVGHDREGGGEGFAFDNEGPRHEVLLRPFRLFSRAVTNGEWLAFVEDGGYRN
PALWLSDGWATVNAEGWEAPAYWRRGEDSGWREFTLLGEHPLDEDAPVCHIGFYEADAFA
RWAGKRLPTEAEWETAAGTVLGSGLSPTGNTLGSGLLRPVAAARGDGLVQMFGDVWEWTA
SAYSGYPGFRPAAGAVGEYNGKFMANQYVLRGGCCATPDGHVRATYRNFFYPHQRWMFSG
VRLAEDA