Protein Info for AZOBR_RS06870 in Azospirillum brasilense Sp245
Annotation: cytochrome B561
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 32% identical to Y703_HISSO: Uncharacterized protein HI0703 homolog from Histophilus somni
KEGG orthology group: None (inferred from 85% identity to azl:AZL_018740)Predicted SEED Role
"FIG139438: lipoprotein B"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See G8AKN2 at UniProt or InterPro
Protein Sequence (192 amino acids)
>AZOBR_RS06870 cytochrome B561 (Azospirillum brasilense Sp245) MLKPLYNRILKLSARKDAVWWMSAVSFAESSFFPLPPDVMLVPMCLAEPKKLWRYTNICA LASLIGGLFGYAVGFYLFESIGRLIIDLYNAQESFQRFQDMFAEFGPWFLILKGITPIPY KLLTITAGFAHLDLTVFILCSIVARFSRFYMIAILLHFYGPQVRDIIEKRLMLVTTVLLV IIIGGLLSFKFV