Protein Info for AZOBR_RS06825 in Azospirillum brasilense Sp245

Annotation: (Fe-S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 30 to 481 (452 residues), 499.2 bits, see alignment E=5.3e-154 PF12801: Fer4_5" amino acids 91 to 130 (40 residues), 30.5 bits, see alignment 1.1e-10 PF13746: Fer4_18" amino acids 214 to 321 (108 residues), 133.7 bits, see alignment E=1.3e-42 PF00037: Fer4" amino acids 268 to 282 (15 residues), 21.5 bits, see alignment (E = 6.6e-08) PF11614: FixG_C" amino acids 357 to 484 (128 residues), 106.7 bits, see alignment E=3.5e-34

Best Hits

KEGG orthology group: None (inferred from 75% identity to azl:AZL_e02910)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AKM3 at UniProt or InterPro

Protein Sequence (487 amino acids)

>AZOBR_RS06825 (Fe-S)-binding protein (Azospirillum brasilense Sp245)
MPDGSAVTPAKIQFFESQKKIHPKAVSGRYRRWKTILTWVLLAVFFIAPWIRWERGPDAP
AQAVLFDLTTPRFFIFWIEIWPQEIYYLTGVLIVAALGLFLATALAGRVWCGFTCPQTVW
TDLFVWIERAFEGDRAERIRLDKAPWSAKKVLRKTGKHAGWLALSVITGFGFVAFFTDAP
RLAVDLLTFNATYEAAGFFALFAGMTYVMAGWTREQMCYYMCPWPRIQTAMLDEHSLVVT
YDTLRGDTRGPKRKSQSWDERRTKGFGDCIDCGQCVQVCPVGVDIRTGEQADCINCGLCA
DACDNIMVSQELPKGLIRFDSLAAQDTRAQGKTYQWRLIRPRTIVYGLLMLVITGAMAWS
YALRPRLDIAVQRDRAPLFVTLQDGTIRNAYTFKVSNKTRQDRSYTLAAAGIAGAEVKVV
GERDEDSGSAVSHISASPDSVATYRVYVTVPRDSVPDASTPVTFQLTDTNNGDRDSYKSV
FLAPGSK