Protein Info for AZOBR_RS06280 in Azospirillum brasilense Sp245

Annotation: membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 224 to 247 (24 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 31 to 272 (242 residues), 91.9 bits, see alignment E=2.7e-30

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AK96 at UniProt or InterPro

Protein Sequence (362 amino acids)

>AZOBR_RS06280 membrane protein of unknown function (Azospirillum brasilense Sp245)
MKDLSSQDASAMPAEAVTLPAGKPGGRLMLLAKLAVTLAVLGVLGVNADWPALLARVTGA
DPVWLAAGFMAKLLAVVCAGERWRDALRAAGERVSHALAMRLMFTGLFFGQVLPGALGGD
VVRGWLTYRGGASSTAVVLALVLDRLLALVGCVLLLFLGLPHLVATAPPSVAWAGPVAVV
LLALGMVVGLQADRLPLPGVLLRPPVRAMQAQVARLRGALLSRAALAGLLHSAAVHACTV
FAVIAYAHALGIPVRVLDALAVVPMTIFAAALAHLAERLGCAGRRLRRRLRTLRARRHRR
AGPVVDDRAVGHPVVASRRPALAQPEGSEGGWAALSPGQRPAGGVAHHLARVFQKAFGRP
FG