Protein Info for AZOBR_RS06270 in Azospirillum brasilense Sp245

Annotation: ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 44 (18 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 154 to 171 (18 residues), see Phobius details amino acids 178 to 195 (18 residues), see Phobius details amino acids 201 to 216 (16 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 314 to 337 (24 residues), see Phobius details amino acids 349 to 368 (20 residues), see Phobius details amino acids 370 to 372 (3 residues), see Phobius details PF04932: Wzy_C" amino acids 186 to 328 (143 residues), 71.7 bits, see alignment E=3e-24

Best Hits

KEGG orthology group: None (inferred from 67% identity to azl:AZL_d00270)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AK94 at UniProt or InterPro

Protein Sequence (394 amino acids)

>AZOBR_RS06270 ligase (Azospirillum brasilense Sp245)
ILAGLAGVAVAALGPLAAMAPRGLPVWAILIALVGLAGLARRGALGRLQRAMPGTAVVLA
FLVLASLSILWSPSPRAGLTVVEIGYIGLGALAGGAWLSSLPGVEARRLTGLFLVGVFAG
VLLFAVEAALDFPLHRWWNHVPAGVEIAETNVPKRTAVLLCLLVWPAAMALDRAGRRGLA
VALPAVFAAACLLLTSRSAMLGIAVGGVAFALAVWSPRLVRGALAAVLGVAFAFVLPLVL
LFDRVLNLDGADWLFRSAQHRVEIWGMAASRALETPVFGQGIDASRALDPEGAVSRFGTL
TDSLLPLHPHNAFLQVWLELGGVGAALALAASLLLLFGTERMERRLQPFALALFASGLAM
ASTAYGIWQAWWMGGMLAAGLMLRLAARTPAGGE