Protein Info for AZOBR_RS05775 in Azospirillum brasilense Sp245

Annotation: translation factor Sua5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 TIGR00057: tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family" amino acids 15 to 209 (195 residues), 190.5 bits, see alignment E=9.6e-61 PF01300: Sua5_yciO_yrdC" amino acids 21 to 198 (178 residues), 200.5 bits, see alignment E=1.7e-63 PF03481: Sua5_C" amino acids 202 to 320 (119 residues), 92.3 bits, see alignment E=4e-30

Best Hits

KEGG orthology group: K07566, putative translation factor (inferred from 77% identity to azl:AZL_023880)

Predicted SEED Role

"TsaC protein (YrdC domain) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AJX5 at UniProt or InterPro

Protein Sequence (323 amino acids)

>AZOBR_RS05775 translation factor Sua5 (Azospirillum brasilense Sp245)
VTDKHPDIIPATPAGLARAGEALRSGELVAFPTETVYGLGGDATDDRAVAAIFAAKGRPQ
FNPLIAHVPDLEAAEAIAVLDERAVELAHQFWPGPLTLVLPRRAEAGLSLLVSAGLDSVA
VRVPAHPVAQALLKAASKPIAAPSANRSGAVSPTAPHHVIESLGDRVSMVVAGGKCQVGV
ESTVLDLTGETPVLLRPGAVLREEIERLIGPIQLSAGNPDAPKSPGQLESHYAPNAPVRL
NATSAEEDEAFLTFGPDRFIRGGKARLNLSLQGDLNEAAANLFAHLRALDQEGVRAIAVM
PIPDEGLGVAINDRLRRAAAPRG