Protein Info for AZOBR_RS05740 in Azospirillum brasilense Sp245

Annotation: phosphatidylcholine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 37 to 54 (18 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details

Best Hits

Swiss-Prot: 57% identical to PCS_PSEAE: Phosphatidylcholine synthase (pcs) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01004, phosphatidylcholine synthase [EC: 2.7.8.24] (inferred from 73% identity to azl:AZL_005000)

Predicted SEED Role

"Phosphatidylcholine synthase (EC 2.7.8.24)" in subsystem ZZ gjo need homes (EC 2.7.8.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AJW8 at UniProt or InterPro

Protein Sequence (231 amino acids)

>AZOBR_RS05740 phosphatidylcholine synthase (Azospirillum brasilense Sp245)
IVRRLSAWGVHAFTGSGVVLGLLALLAAVNGEAKACLGWLGLALVVDGVDGTLARRASVK
EVLPGIDGSALDLVVDYLTYVVVPAVFLYRFGLLPDGLGVALAAFIMMTSLYCFSNTGMK
SGDNYFVGFPAIWNVVALYLWLLALDPWVNTAVVLVLGLLTFTTVKFLHPFRVRRWMRLN
LLVSGAWLASSAALVVLYPDRPDAVWYVWLASSAYYAAICAWRTLRGPAQA