Protein Info for AZOBR_RS05405 in Azospirillum brasilense Sp245

Annotation: glucokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02685: Glucokinase
  • amino acids 1 to 309 (309 residues), 372.8 bits, E=6.6e-116
• TIGR00749: glucokinase
  • amino acids 1 to 303 (303 residues), 308.3 bits, E=3.1e-96

Best Hits

Swiss-Prot: 52% identical to GLK_NITHX: Glucokinase (glk) from Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)

KEGG orthology group: K00845, glucokinase [EC: 2.7.1.2] (inferred from 77% identity to azl:AZL_002850)

MetaCyc: 46% identical to glucokinase (Escherichia coli K-12 substr. MG1655)
Glucosamine kinase. [EC: 2.7.1.8]; Hexokinase. [EC: 2.7.1.8, 2.7.1.1, 2.7.1.2]

Predicted SEED Role

"Glucokinase (EC 2.7.1.2)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis (EC 2.7.1.2)

MetaCyc Pathways

• Bifidobacterium shunt (15/15 steps found)
• homolactic fermentation (11/12 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• glycogen degradation I (7/8 steps found)
• heterolactic fermentation (14/18 steps found)
• glycogen degradation II (5/6 steps found)
• sucrose biosynthesis II (6/8 steps found)
• sucrose degradation III (sucrose invertase) (3/4 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis II (4/6 steps found)
• trehalose degradation I (low osmolarity) (1/2 steps found)
• trehalose degradation II (cytosolic) (1/2 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• trehalose degradation IV (1/3 steps found)
• 1,3-propanediol biosynthesis (engineered) (5/9 steps found)
• chitin biosynthesis (5/9 steps found)
• chitin derivatives degradation (4/8 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.1 or 2.7.1.2 or 2.7.1.8

Sequence Analysis Tools

See G8AJP4 at UniProt or InterPro

Protein Sequence (311 amino acids)

>AZOBR_RS05405 glucokinase (Azospirillum brasilense Sp245)
LVADIGATNARFGLIDGTGIHGSRVLRCADFPSLEAAALAYLGGVAHDARPSRGAFAIAG
PVTGDAVLMTNRGWSFSTAEVRGKLGLERLAVINDFTAVALSVPRLTAADVRQVGEGAPV
PGRVVGVVGPGSGLGVSGLVPGAEGWTALAAEGGHVTMAPVSDRESAVLAQLRKSFEHVS
AERVLSGPGLVNLYQALCVLDHQEPEPFTPAQVSDAATANTNPHCVEAVEMFCAMLGTVA
GNLALTLGARGGIYIAGGIVPKLGTLFTHSRFRKRFMEKGRMRDFLAPIPTYVITHELPA
FLGLAEAAERA