Protein Info for AZOBR_RS05400 in Azospirillum brasilense Sp245

Annotation: DNA polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF03167: UDG" amino acids 20 to 189 (170 residues), 86 bits, see alignment E=1.4e-28

Best Hits

KEGG orthology group: None (inferred from 77% identity to azl:AZL_007540)

Predicted SEED Role

"Uracil-DNA glycosylase, family 4"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AJP3 at UniProt or InterPro

Protein Sequence (201 amino acids)

>AZOBR_RS05400 DNA polymerase (Azospirillum brasilense Sp245)
MDARMTDLPFADYQQPTKTAAGPRLAIVGEAPGAEEARRGAPFVGRSGQLLDETLKAAGV
ERAECLVANVFRYQPPGNKVGHFFASRTRARKEGRALDERWGPFGTSDWVLAEFSGEIEH
LQRTLEGFAPRVIVALGRTPLWALTGLNGIMQLRGTVQPCRLVPGAEVVATFHPSYILRG
QLAEQPTFLADLKLAVSRLTA