Protein Info for AZOBR_RS05345 in Azospirillum brasilense Sp245

Annotation: cell division inhibitor MinD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF13614: AAA_31" amino acids 2 to 161 (160 residues), 70.8 bits, see alignment E=4.2e-23 PF10609: ParA" amino acids 3 to 239 (237 residues), 56.5 bits, see alignment E=8.6e-19 TIGR01968: septum site-determining protein MinD" amino acids 3 to 267 (265 residues), 357.2 bits, see alignment E=2.4e-111 PF06564: CBP_BcsQ" amino acids 4 to 148 (145 residues), 23.5 bits, see alignment E=1.1e-08 PF09140: MipZ" amino acids 4 to 143 (140 residues), 37 bits, see alignment E=7.1e-13 PF02374: ArsA_ATPase" amino acids 5 to 40 (36 residues), 31.6 bits, see alignment 3.1e-11 PF01656: CbiA" amino acids 5 to 226 (222 residues), 69 bits, see alignment E=1.1e-22

Best Hits

Swiss-Prot: 73% identical to MIND_ECOLI: Septum site-determining protein MinD (minD) from Escherichia coli (strain K12)

KEGG orthology group: K03609, septum site-determining protein MinD (inferred from 94% identity to azl:AZL_007460)

Predicted SEED Role

"Septum site-determining protein MinD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AJN0 at UniProt or InterPro

Protein Sequence (271 amino acids)

>AZOBR_RS05345 cell division inhibitor MinD (Azospirillum brasilense Sp245)
LGKIIVMTSGKGGVGKTTSSAAFATGLALRGFKTVVIDFDVGLRNLDLIMGCERRVVFDF
INVINGEAKLSQALIKDKRIDNLSILPTSQTRDKDALTREGVEKVLNELSKDFDYIVCDS
PAGIERGALMALYFADHAVIVTNPEVSSVRDSDRILGVLASRSRRAEQGLEPVTQQLLLT
RYDPERVERGEMLKVDDVLEILAIPLLGVIPESQAVLRASNVGMPVILDEASNAGQAYLD
SVSRFLGEDVEHRFVTPQKKGLFSRLLRRSA