Protein Info for AZOBR_RS05060 in Azospirillum brasilense Sp245

Annotation: zinc protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 PF00675: Peptidase_M16" amino acids 32 to 177 (146 residues), 97 bits, see alignment E=1e-31 PF05193: Peptidase_M16_C" amino acids 186 to 367 (182 residues), 119 bits, see alignment E=2.3e-38

Best Hits

Swiss-Prot: 50% identical to Y4WA_SINFN: Uncharacterized zinc protease y4wA (NGR_a01040) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 79% identity to azl:AZL_007030)

Predicted SEED Role

"Peptidase, M16 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AJG3 at UniProt or InterPro

Protein Sequence (440 amino acids)

>AZOBR_RS05060 zinc protease (Azospirillum brasilense Sp245)
LAGAVPAATPAFAAEKGVFFPETFTLSNGMQVVLVTNQRVPVVTHMVWYKVGAADEPRGV
SGIAHFLEHLMFKGTEEVPPGAFSRIVAKNGGRDNAFTSWDYTAYFQNVARDRLELVMKM
EADRMSNLRLTDQLVYPERDVIIEERRQRIENEPADRIGEQVNATLYVHHPYGTPIIGWP
QEMATLTREEAESFYKSWYAPNNAVLVVSGDVTAEELKPLAEKYYGGIPTRPVPERVRVQ
EPPISAARRVILRDDEVRQPSIRRNWLAPSYRTDKEGYAYPLQVLSEIMSGGPTSRLYRS
LVVDQRIATSAWLGYSPSSWDMTSLAAGASPAPGVTMEKLEAALEADIRTLVEKGVTEEE
VTTAKKRMLAEAAYARDSLTGPAQTLGAAIATGQSIDDVENWPVRIDAVTADQVNAAARA
VLGQTNHVTGLLLPLQDKGS