Protein Info for AZOBR_RS04500 in Azospirillum brasilense Sp245

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF03602: Cons_hypoth95" amino acids 1 to 185 (185 residues), 146.7 bits, see alignment E=6.2e-47 TIGR00095: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD" amino acids 2 to 186 (185 residues), 128.3 bits, see alignment E=1.5e-41 PF13649: Methyltransf_25" amino acids 54 to 116 (63 residues), 27.1 bits, see alignment E=5.5e-10

Best Hits

KEGG orthology group: K08316, ribosomal RNA small subunit methyltransferase D [EC: 2.1.1.171] (inferred from 74% identity to azl:AZL_019800)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.171

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AJ34 at UniProt or InterPro

Protein Sequence (192 amino acids)

>AZOBR_RS04500 methyltransferase (Azospirillum brasilense Sp245)
VRIVGGKHRGRRLAAPGGSDTRPTTDRTRESLFNILSHADWGPDGADLLEGAVVVDAFCG
TGALGLEALSRGAAHVSFLDMGRAALDAVRANAAALGEGANAAVLRADATRPPPPPGCPC
TLAFLDPPYGQDLAPRALAGLAKAGWLAPGAVLVVEVAGRDPLPLPPGFAELDERRYGDT
RVQFLRYGVPQP