Protein Info for AZOBR_RS04365 in Azospirillum brasilense Sp245

Annotation: phosphoribosylformylglycinamidine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00302: phosphoribosylformylglycinamidine synthase, purS protein
  • amino acids 1 to 78 (78 residues), 111.1 bits, E=1.1e-36
• PF02700: PurS
  • amino acids 2 to 78 (77 residues), 121.6 bits, E=6.3e-40

Best Hits

Swiss-Prot: 47% identical to PURS_METJA: Phosphoribosylformylglycinamidine synthase subunit PurS (purS) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01952, phosphoribosylformylglycinamidine synthase [EC: 6.3.5.3] (inferred from 98% identity to azl:AZL_006350)

Predicted SEED Role

"Phosphoribosylformylglycinamidine synthase, PurS subunit (EC 6.3.5.3)" in subsystem De Novo Purine Biosynthesis (EC 6.3.5.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.3

Use Curated BLAST to search for 6.3.5.3

Sequence Analysis Tools

See G8AJ04 at UniProt or InterPro

Protein Sequence (80 amino acids)

>AZOBR_RS04365 phosphoribosylformylglycinamidine synthase (Azospirillum brasilense Sp245)
MKAKVHVTLKRGVLDPQGKAIAHALHTLGFDGVEDVRAGKVIELQLKSTDEAAARKEVEA
MCSKLLANTVIEDYAIELVA