Protein Info for AZOBR_RS03910 in Azospirillum brasilense Sp245

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details PF14358: DUF4405" amino acids 25 to 76 (52 residues), 28 bits, see alignment E=1.3e-10

Best Hits

KEGG orthology group: None (inferred from 55% identity to azl:AZL_018640)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AIQ1 at UniProt or InterPro

Protein Sequence (186 amino acids)

>AZOBR_RS03910 membrane protein (Azospirillum brasilense Sp245)
LAAFRSTREPSFPMPSISSTITRQIVTPVTIVLFVVSTVTGIMLLLHWNGNLVRFSHEWL
SVGFSAIGLWHLARNWTAFLQYFKRNVALSAFVVSVVGSLVFTAMTGTPASTGGPGAMMR
AVANAPLATVAPVFGLDPEKAIQALKAANIEAQPGESLSAIGTRAGMNAVGVANILTAAK
QPRPAS