Protein Info for AZOBR_RS03890 in Azospirillum brasilense Sp245

Annotation: methyltransferase UbiE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF13489: Methyltransf_23" amino acids 194 to 351 (158 residues), 40.8 bits, see alignment E=5.8e-14 PF13847: Methyltransf_31" amino acids 198 to 306 (109 residues), 36.4 bits, see alignment E=1.4e-12 PF01209: Ubie_methyltran" amino acids 200 to 307 (108 residues), 39.7 bits, see alignment E=1.1e-13 PF13649: Methyltransf_25" amino acids 203 to 298 (96 residues), 66.5 bits, see alignment E=8.9e-22 PF08242: Methyltransf_12" amino acids 203 to 300 (98 residues), 51.4 bits, see alignment E=4.5e-17 PF08241: Methyltransf_11" amino acids 203 to 302 (100 residues), 64.3 bits, see alignment E=4.1e-21

Best Hits

KEGG orthology group: None (inferred from 63% identity to rce:RC1_2416)

Predicted SEED Role

"SAM-dependent methyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AIP7 at UniProt or InterPro

Protein Sequence (368 amino acids)

>AZOBR_RS03890 methyltransferase UbiE (Azospirillum brasilense Sp245)
MNRLTPPSFAQRAPRPAPRLAPRLAYAASQSARVAWFLGQYMMAARIGRRITGPPRTTPP
GGRPVPGTRAILEELRTLLARDLANIEAGYYRLPHDLMPDPRRLLTDAAAFFRDVPEVSR
RRRDHAAVEVRANPPPGSGGLPAYYRQNFHYQTGGYLTEESARLYDHQVEVLFGGGADAM
RRQVLVPIFEHLKTRRSADCRLLDVAAGTGRFLTFVKDNHPRLPVTALDLSPAYLREARR
NLVPWARSSALVQAAAEAIPLATGSQDIVTCIYLFHELPPKIRAQAAAEMARVLKPGGIL
VLMDSVQYGDNPMMDGLIDRFPQSFHEPFYAHYARDDLPALFAAAGLRLRETSLAYMSKL
LVLEKTDP