Protein Info for AZOBR_RS03835 in Azospirillum brasilense Sp245

Annotation: aquaporin Z

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details PF00230: MIP" amino acids 2 to 225 (224 residues), 188.3 bits, see alignment E=8.9e-60 TIGR00861: MIP family channel proteins" amino acids 9 to 225 (217 residues), 213.3 bits, see alignment E=2e-67

Best Hits

Swiss-Prot: 72% identical to AQPZ_PSEPK: Aquaporin Z (aqpZ) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K06188, aquaporin Z (inferred from 72% identity to ddr:Deide_1p01582)

MetaCyc: 70% identical to water channel AqpZ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-145

Predicted SEED Role

"Aquaporin Z"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AIN3 at UniProt or InterPro

Protein Sequence (246 amino acids)

>AZOBR_RS03835 aquaporin Z (Azospirillum brasilense Sp245)
MSMVRRTSAEFLGTFWLVFGGCGSAVLSAAFPEVGIGLTGVSLAFGLTVLTMAYSVGHIS
GCHLNPAVTVGLWAGGRFPAKDILPYVIAQVVGAFLAAMVLYVIATGKADWSLAAKGLAA
NGYGEHSPGAYNLTSGLLIEVVLTFMFLIVILGSTDRRAPAGFAPLAIGLALTLIHLISI
PVTNTSVNPARSTGPALVVGGWALQQLWAFWVAPLVGGLLGGLAYRALAEEMPPKPAITG
EARPST