Protein Info for AZOBR_RS03820 in Azospirillum brasilense Sp245

Annotation: microcin C ABC transporter permease YejB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 172 to 198 (27 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 285 to 312 (28 residues), see Phobius details amino acids 335 to 358 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 155 to 362 (208 residues), 120.7 bits, see alignment E=6.3e-39

Best Hits

Swiss-Prot: 64% identical to YEJB_ECOLI: Inner membrane ABC transporter permease protein YejB (yejB) from Escherichia coli (strain K12)

KEGG orthology group: K13894, microcin C transport system permease protein (inferred from 89% identity to azl:AZL_004260)

MetaCyc: 64% identical to putative oligopeptide ABC transporter membrane subunit YejB (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AIN0 at UniProt or InterPro

Protein Sequence (369 amino acids)

>AZOBR_RS03820 microcin C ABC transporter permease YejB (Azospirillum brasilense Sp245)
MLAYIIRRLLLIIPTLFGIMVINFLIVQIAPGGPIEQMIARVQGTAVEATARIGGTGGGE
TGGPAAQQAQGGDTGSRYRGAQGLDPEFIKQLEKEFGFDKPLHERFIHMMSNYLMFDFGK
SYFRDRSVVDLVIEKMPVSISLGIWTTLIVYLVSIPLGIAKAVRDGQPFDVWTSGVVIVG
YAIPSFLFAVLLIVVFAGGRYFDLFPLRGLVSDNWASLPWWRQILDYAWHMVLPVLSMVI
GGFAGLTMLTKNSFLEEINKQYVVTARAKGLAERRVLYGHIFRNAMLIVIAGFPGAFIGI
LFTGALLIEVIFSLDGLGLLGFEAAINRDYPVMFGTLYFFTLLGLIMNLVGDVTYVAVDP
RIDFEARRV