Protein Info for AZOBR_RS03800 in Azospirillum brasilense Sp245

Annotation: microcin ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 PF00005: ABC_tran" amino acids 27 to 187 (161 residues), 103.4 bits, see alignment E=5.7e-33 amino acids 305 to 455 (151 residues), 110.8 bits, see alignment E=3e-35 PF08352: oligo_HPY" amino acids 238 to 270 (33 residues), 23.4 bits, see alignment (E = 2.2e-08) amino acids 506 to 537 (32 residues), 20.1 bits, see alignment (E = 2.4e-07)

Best Hits

Swiss-Prot: 58% identical to YEJF_ECOLI: Uncharacterized ABC transporter ATP-binding protein YejF (yejF) from Escherichia coli (strain K12)

KEGG orthology group: K13896, microcin C transport system ATP-binding protein (inferred from 87% identity to azl:AZL_004240)

MetaCyc: 58% identical to putative oligopeptide ABC transporter ATP binding subunit YejF (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AIM6 at UniProt or InterPro

Protein Sequence (543 amino acids)

>AZOBR_RS03800 microcin ABC transporter ATP-binding protein (Azospirillum brasilense Sp245)
MTDSNDLLQVRNLHVEFRSGGGAMHAVKGVSFDIAKGETLALVGESGSGKSVTALSILQL
LPYPMARHPHGSIRFRGTELVGAEEKVLRDVRGDRIAMIFQEPMTSLNPLHSIERQINET
LFLHKGLSRAAARKRTLELLRLVGLPNPEKRLNAYPHELSGGQRQRVMIAMALANEPDLL
IADEPTTALDVTIQAQILELLKDLQRRFGMALLLITHDLGVVRKMADRVCVMNQGEIVEQ
ADVADIFARPQHAYTRKLLAAEPKGDPLTPPADAPEVMAADNLKVWFPIKKGLLRRTVDH
VRAVDGVSVNVRQGHTVGVVGESGSGKTTLGLALLRLHASEGAIRFDGKDIQGWQAKKLR
GLRREMQVVFQDPYGSLSPRLSVGQIIGEGLTIHGIGSGAERDAMVAKALEEVGLDPSSR
HRYPHEFSGGQRQRIAIARALVLKPKFVVLDEPTSALDMSVQAQIVDLLRDIQARNNLAY
LFISHDLRVVRALSSHVIVMKDGKVVEQGPTRRIFEEPREEYTRALLAAALNLEAVKSDA
VRM