Protein Info for AZOBR_RS03605 in Azospirillum brasilense Sp245

Annotation: signal protein PDZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 PF04187: Cofac_haem_bdg" amino acids 35 to 241 (207 residues), 229.8 bits, see alignment E=7.5e-72 PF00595: PDZ" amino acids 286 to 353 (68 residues), 26.1 bits, see alignment E=1.9e-09 PF13180: PDZ_2" amino acids 287 to 361 (75 residues), 41.7 bits, see alignment E=2.5e-14 PF17820: PDZ_6" amino acids 302 to 355 (54 residues), 31 bits, see alignment 3.7e-11

Best Hits

KEGG orthology group: None (inferred from 46% identity to nmu:Nmul_A2382)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AIH6 at UniProt or InterPro

Protein Sequence (373 amino acids)

>AZOBR_RS03605 signal protein PDZ (Azospirillum brasilense Sp245)
LGDTATAQAAARTDACVPPGGWADAAARPLNAADLLRRAAASPAVLLGERHDNADHHRWQ
LHSLAALHALNPDLAVGMEMFPRSVQPVLDRWSAGQLTEAELLRETNWPKVWGYDARFYL
PILHFARMNRLPVVALNVDRGLVSRTAREGWAAVPANEREGVGDPAPPPASYTERLRQVM
AAHGPGERRSGSFERFVEAQSVWDRAMAERIAETHRQTNRTVVAILGQGHIEGRDGVPHQ
LADLGIRNSVVLLPWDEDRPCAELDGRIADAVYGLGESEAPAETPRPRLGVMLEPGPDGV
RVRSVTEGSVAAAAGLTAGDLVVAAAGSPVREATDLTTVVQRQAPGTWLPLTVKREQGTA
ELVAKFPASPTVE