Protein Info for AZOBR_RS03465 in Azospirillum brasilense Sp245

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 67 to 92 (26 residues), see Phobius details amino acids 108 to 133 (26 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 62% identity to azl:AZL_005070)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AIA5 at UniProt or InterPro

Protein Sequence (189 amino acids)

>AZOBR_RS03465 membrane protein (Azospirillum brasilense Sp245)
MPLTARDVASSVFGAYRLARFDPTGLQHLDRTPEGAWKSFYAAVIVAPAWTLLLAIRLWG
QVPDTPLFQLVVVEAIAYVISWTAFPVVMHGVSGLLDRQSRYIDFLCAYNWSSVVQMSIY
LPVVILAATGILPGPISEGLVFGIMLAMLTYQWFVMRTALDISGVAAAVLVLLDLFLSAL
ITDFADGLL