Protein Info for AZOBR_RS03430 in Azospirillum brasilense Sp245

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 20 to 22 (3 residues), see Phobius details amino acids 31 to 52 (22 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 109 to 138 (30 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 203 to 208 (6 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details PF01061: ABC2_membrane" amino acids 34 to 225 (192 residues), 31.8 bits, see alignment E=5.5e-12

Best Hits

KEGG orthology group: None (inferred from 84% identity to azl:AZL_d02600)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AI97 at UniProt or InterPro

Protein Sequence (270 amino acids)

>AZOBR_RS03430 ABC transporter (Azospirillum brasilense Sp245)
MVHPNPAFSLRRVGAMVLRYWYLLRGSWPRFLELAYWPTMQMILWGYINQFMASSSAWVA
QGAGVLVSAVLLWDVLFRGQLGVSVSFLEEMWSRNLGHLFVSPLRPGEWVAALFGMSLIR
TVIGVVPAALLAIPLFGYSLFDLGLPLAGFFANLIVFGWSLGLVIVALILRYGMGAEGLA
WIVVFMLAPVSAVYYPVSVLPGWLQWVALSLPSAHVFEGMRAILFDGTMRWDHLAWAVGL
NALFMGLCTAAFLYSFHQARVRGALLQTGE