Protein Info for AZOBR_RS03390 in Azospirillum brasilense Sp245

Annotation: protein tyrosine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 757 transmembrane" amino acids 46 to 66 (21 residues), see Phobius details amino acids 471 to 490 (20 residues), see Phobius details PF02706: Wzz" amino acids 38 to 122 (85 residues), 47.6 bits, see alignment E=2.6e-16 PF13807: GNVR" amino acids 417 to 492 (76 residues), 50.2 bits, see alignment E=3e-17 PF13614: AAA_31" amino acids 561 to 719 (159 residues), 34.3 bits, see alignment E=3.5e-12

Best Hits

KEGG orthology group: None (inferred from 71% identity to azl:AZL_d02550)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AI88 at UniProt or InterPro

Protein Sequence (757 amino acids)

>AZOBR_RS03390 protein tyrosine kinase (Azospirillum brasilense Sp245)
LATQDIQDQPQRRQSAPVPGPVSFDLSTAAASAVRRTTGMLLRHKLLIGTVIVLGTGIAG
LVALRMTPLYTAQTLIMVEHRKNQVMNYQEVVSGLSTELGALQSEVAILKSPAFAEKVVD
KLGLMNDPEFNAALRPEQTNWFYYLNPKNLVPDSWWNSARGDRPEIALSPEEKTANERTS
VVNSFIENLAVRPQGRSYVIAVDFDSEDPRKASLIANTIGEMYLVDQLDEKFKAAKRATA
WLEERITELRREAKMTGEAAEKYRAESGLTNANGETTLIAQQLAELNTSYVLARTKRQEA
EAKLREVSTLAQSPRGVSAIGDVLGSPLIQALRQQEVELQRKIADAANKYGARHPTLTAL
QSELRDLQGQIKADVGRIVQNLSNEVELERGREAALKTNLDQLQAQRNQQQESNVTLRTL
ERDAETSQTMYEAMLTRFQEIAGQTEIQQPDARIVSEAAIPLNPSQPNKKMIVLLALVAS
ATLGVLLAMLREQSERGFRSPHQFESATGVRSLGIVPAIGRRRRGTSPADYAIEKPMSAF
AEAMQNLRTTLLLANPDGHQRVILFSSSVPGEGKSSIAAAFARICANAGQKTIILDCDMR
RKGLHPMLGLENRHGLYEVLSGECAPNEVIQTDPRTGLHFIASGRGSALPQDMLGSSRMH
QLISRLALEYDRVILDSPPVLAVSEGKLLAALADQTVFIVHWGKTKRETAMAGLKEIVEA
GGEVVGVLFSQVDIRRHAQYEFPDSGRYHGYRRYYAN