Protein Info for AZOBR_RS03240 in Azospirillum brasilense Sp245

Annotation: recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF02899: Phage_int_SAM_1" amino acids 2 to 71 (70 residues), 48.6 bits, see alignment E=8e-17 PF00589: Phage_integrase" amino acids 93 to 270 (178 residues), 146.6 bits, see alignment E=6.5e-47

Best Hits

Swiss-Prot: 52% identical to XERD_CAUVC: Tyrosine recombinase XerD (xerD) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 74% identity to azl:AZL_000870)

Predicted SEED Role

"Tyrosine recombinase XerD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AI54 at UniProt or InterPro

Protein Sequence (293 amino acids)

>AZOBR_RS03240 recombinase XerD (Azospirillum brasilense Sp245)
LNTRMAYERDLADLALWLAQRGQPLEKAVTEDLRAYLAFQYVEGGQKPAPRTLARRLSAM
RQFYRFLVSEGRRADDPASALDSPKQGRPLPKILTVEEVTRMIDSAQTRGGPEGLRLVAL
LEVLYATGLRVSELVGLPMAAILRDGRGLIVRGKGGKERMVPLSEPASAALNVYLPWRSH
FILAGRENGPVAFLFPSRSSTNGHLTRQRFAQLLKELAIESNIDPEKVSPHVLRHAFATH
LLDRGADLRSVQKMLGHADIATTQIYTHVVSERLKQVVHEHHPLARRKTIRTQ