Protein Info for AZOBR_RS03165 in Azospirillum brasilense Sp245

Annotation: iron deficiency-induced protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13531: SBP_bac_11" amino acids 41 to 293 (253 residues), 69 bits, see alignment E=1.1e-22 PF13416: SBP_bac_8" amino acids 43 to 310 (268 residues), 90.6 bits, see alignment E=3.2e-29 PF01547: SBP_bac_1" amino acids 43 to 288 (246 residues), 85.9 bits, see alignment E=1.1e-27 PF13343: SBP_bac_6" amino acids 76 to 303 (228 residues), 86.7 bits, see alignment E=3.5e-28

Best Hits

Swiss-Prot: 58% identical to IDIA_THEEB: Iron deficiency-induced protein A (idiA) from Thermosynechococcus elongatus (strain BP-1)

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 62% identity to ter:Tery_3377)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AI35 at UniProt or InterPro

Protein Sequence (342 amino acids)

>AZOBR_RS03165 iron deficiency-induced protein A (Azospirillum brasilense Sp245)
MHIGSRGVFAATFAATLLTMTGLASAAEVNIYSARHYDVDKDLYDAFTKKTGIKINVIEG
KEEELIERMKTEGGNSPADVFITVDAGRLWRAQEAGLLQPTRSKVMEEAIPAHLREPEGH
WFGISKRARILVYNKASVKPDEIKTYEELADPKWKDRVLVRSSTSVYNQSLVGSLLAAHG
EKATEEWAKGVVANMARKPQGGDTDQIKGVAANEGDVAVTNTYYFARIASSSKPEDKAIA
EKLGVIFPNQGDRGTHVNVSGAGVMKNAPNKEQAVQFLEYLVSPEAQKMFTEKNYEYPIV
AGAETAPVLVTWGKFKEDPLNAAVYGKNNAEALKIMDRAGWK