Protein Info for AZOBR_RS02955 in Azospirillum brasilense Sp245

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details transmembrane" amino acids 279 to 301 (23 residues), see Phobius details PF07568: HisKA_2" amino acids 352 to 425 (74 residues), 83.9 bits, see alignment E=1.3e-27 PF07536: HWE_HK" amino acids 352 to 405 (54 residues), 25 bits, see alignment 5.4e-09 PF13581: HATPase_c_2" amino acids 436 to 528 (93 residues), 43.7 bits, see alignment E=5.2e-15 PF02518: HATPase_c" amino acids 448 to 553 (106 residues), 54.4 bits, see alignment E=3.2e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AHY9 at UniProt or InterPro

Protein Sequence (562 amino acids)

>AZOBR_RS02955 histidine kinase (Azospirillum brasilense Sp245)
MPLRALRSKGSPLLYRMPGSALVLMVCAVALLLTLGLSASFALRDRAAALQHAQDTAGNA
SLLVAEHAARLVETSDLILKQAVQLAGPAGAPLPSDRAGWERYAALVRGTPYLVSIWLFD
AEGNPVLSTRRFPTPAMNVADRDYFVAQRTGGSEAGGNLFITALDNSRYSQEPLILLSRP
LAAAPGQFRGVALVAVSPRYIRDIYKSFDFDYARSITLRRADGTVLLHETQGPDATDSAP
AEAAGEPEISALRRVDSVPLTAEVAIPVSSVMERWHGQLWTYISYALAALAAVSVVGGMA
LQRARRERQAENALQHAYDTLEERVHQRTAELERTNAQLETAVTDKEVLLKEVQHRVKNN
LQVICSLLRLQAARIDEPARRAFDESLRRIQCMSLMQELLYRSDQPARIDFADYLRQLCD
GLVRSTNPTGARLTVNAPQPWSLDVDQATPLALIASELVSNALLHAFPLGHPGTVSVELL
PEGSEGMRMVVRDDGTGLPPDPSAPQSRATDKRQSGLGLVLVRALAQQAGAAVTIDRQPD
GGPGTRFIVSVPTLSKAQTKAA