Protein Info for AZOBR_RS02885 in Azospirillum brasilense Sp245

Annotation: ankyrin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13637: Ank_4" amino acids 34 to 83 (50 residues), 28.7 bits, see alignment E=3.2e-10 amino acids 74 to 116 (43 residues), 34.7 bits, see alignment 4.2e-12 PF12796: Ank_2" amino acids 37 to 124 (88 residues), 69.5 bits, see alignment E=7.5e-23 amino acids 110 to 186 (77 residues), 43.9 bits, see alignment E=7.2e-15 PF13606: Ank_3" amino acids 63 to 90 (28 residues), 21.2 bits, see alignment 7.3e-08 amino acids 96 to 123 (28 residues), 23.2 bits, see alignment 1.5e-08 amino acids 129 to 155 (27 residues), 22.2 bits, see alignment 3.2e-08 PF00023: Ank" amino acids 63 to 94 (32 residues), 24.6 bits, see alignment 5.9e-09 amino acids 96 to 126 (31 residues), 29.4 bits, see alignment 1.8e-10 amino acids 129 to 159 (31 residues), 25 bits, see alignment 4.3e-09 PF13857: Ank_5" amino acids 68 to 103 (36 residues), 29.8 bits, see alignment 1.5e-10 amino acids 82 to 120 (39 residues), 29.8 bits, see alignment 1.5e-10 amino acids 116 to 166 (51 residues), 27.6 bits, see alignment E=7.4e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AHX3 at UniProt or InterPro

Protein Sequence (187 amino acids)

>AZOBR_RS02885 ankyrin (Azospirillum brasilense Sp245)
MKRLLMLSLLALGLTAPVAAPALAQINLLEGPSMVKAVTSNDASALRLLLLKGENPNQVD
ASGRPVLLLAIGNGHPELVRLLLDGGANPNRADKSGNTPLHYAVEADAPEAVDLLLTKGA
KVDQDNRQGITPLMTAARFGRVDLVERLLKAGAQADRTDFTGRTTLSWAQDSRNARVANL
LRQAGAR