Protein Info for AZOBR_RS02870 in Azospirillum brasilense Sp245

Annotation: mechanosensitive ion channel protein MscL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details PF01741: MscL" amino acids 1 to 131 (131 residues), 146.9 bits, see alignment E=1.8e-47 TIGR00220: large conductance mechanosensitive channel protein" amino acids 2 to 132 (131 residues), 114.1 bits, see alignment E=2.4e-37

Best Hits

Swiss-Prot: 55% identical to MSCL_METFK: Large-conductance mechanosensitive channel (mscL) from Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 82% identity to azl:AZL_025640)

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AHW9 at UniProt or InterPro

Protein Sequence (147 amino acids)

>AZOBR_RS02870 mechanosensitive ion channel protein MscL (Azospirillum brasilense Sp245)
LQEFKTFISRGNVVELAVGIIIGAAFTGIVNSLVKDMLMPPIGWIMGGIDFSNYFLNLSG
GHYESLSAAEAAGAATINYGRFINALINFFIVAGALFLIVRQVNRLHFLQDSKPKAPPRQ
EVLLEEIRDALRARQAPAPGDTTRRGA