Protein Info for AZOBR_RS02680 in Azospirillum brasilense Sp245

Annotation: methionine sulfoxide reductase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 TIGR00357: methionine-R-sulfoxide reductase" amino acids 11 to 131 (121 residues), 147 bits, see alignment E=1.7e-47 PF01641: SelR" amino acids 14 to 129 (116 residues), 157.8 bits, see alignment E=5.6e-51

Best Hits

Swiss-Prot: 68% identical to MSRB_CAUVC: Peptide methionine sulfoxide reductase MsrB (msrB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 69% identity to xca:xccb100_3837)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AH89 at UniProt or InterPro

Protein Sequence (149 amino acids)

>AZOBR_RS02680 methionine sulfoxide reductase B (Azospirillum brasilense Sp245)
LTPPTPEQRAVLVERLSDEERHVLLSHGTEAPFCGGLLDNKKPGTYACRLCGLPLFRSGT
KFESGTGWPSFTAPYENAHLKLVQDNSYGMVRVETLCARCGSHQGHVFPDGPPPTGMRFC
INSVSLAFLPEGQPLARSVQDWVEEGAAF