Protein Info for AZOBR_RS02200 in Azospirillum brasilense Sp245

Annotation: nucleoside-triphosphate diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01725: Ham1p_like
  • amino acids 13 to 196 (184 residues), 207.2 bits, E=1.1e-65
• TIGR00042: non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
  • amino acids 13 to 196 (184 residues), 153 bits, E=3e-49

Best Hits

Swiss-Prot: 66% identical to IXTPA_RHOCS: dITP/XTP pyrophosphatase (RC1_2961) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K01516, nucleoside-triphosphatase [EC: 3.6.1.15] (inferred from 84% identity to azl:AZL_000180)

Predicted SEED Role

"Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15)" in subsystem Heat shock dnaK gene cluster extended (EC 3.6.1.15)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (9/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (8/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (11/14 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (5/7 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (5/8 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.15

Sequence Analysis Tools

See G8AGG3 at UniProt or InterPro

Protein Sequence (200 amino acids)

>AZOBR_RS02200 nucleoside-triphosphate diphosphatase (Azospirillum brasilense Sp245)
MTTPPRRFTGGTLVIASHNKGKVREIAALLGPYAASFVSAGELGLPEPEETGTSFVANAE
LKALAAAKAGHVALADDSGMVVPALNGDPGIYSARWAGPEKDFQMAMGKVEDGLKGQTDR
SAWFVCALSLAWPDGHVETVEGRCPGTLVWPPRGEHGFGYDPMFRPDGYDITFGEMDPAR
KHEMSHRADAFRQLVERCFK