Protein Info for AZOBR_RS01770 in Azospirillum brasilense Sp245

Annotation: dephospho-CoA kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01121: CoaE
  • amino acids 3 to 174 (172 residues), 133 bits, E=5.1e-43
• TIGR00152: dephospho-CoA kinase
  • amino acids 3 to 175 (173 residues), 111.9 bits, E=1.7e-36

Best Hits

Swiss-Prot: 60% identical to COAE_MAGSA: Dephospho-CoA kinase (coaE) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00859, dephospho-CoA kinase [EC: 2.7.1.24] (inferred from 78% identity to azl:AZL_000040)

Predicted SEED Role

"Dephospho-CoA kinase (EC 2.7.1.24)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.24)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (8/9 steps found)
• coenzyme A biosynthesis I (bacteria) (4/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (4/5 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.24

Sequence Analysis Tools

See G8AG71 at UniProt or InterPro

Protein Sequence (214 amino acids)

>AZOBR_RS01770 dephospho-CoA kinase (Azospirillum brasilense Sp245)
MIVLGLTGSIGMGKSTAARMLKRMGALVCDSDAVVHGLLGRHGAAVPAIAAAFPGVVVDG
AVDRRALGAAVFGNPAALKRLEAILHPAVQAAQRRFLKQAARRRVHVAVLDIPLLFETGG
ERKVDRSVVVTAPFLVQKSRVLARPGMTPDKFAAILARQMPDAEKRRRADHVVNTGDGRR
ATRRALRNILADVKRRRGRQWPPRGYQPGQVVHA