Protein Info for AZOBR_RS01705 in Azospirillum brasilense Sp245

Annotation: murein transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03562: MltA
  • amino acids 134 to 299 (166 residues), 215 bits, E=6.4e-68
• PF06725: 3D
  • amino acids 318 to 392 (75 residues), 73 bits, E=1.9e-24

Best Hits

KEGG orthology group: K08304, membrane-bound lytic murein transglycosylase A [EC: 3.2.1.-] (inferred from 73% identity to azl:AZL_028860)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase A precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

See G8AG55 at UniProt or InterPro

Protein Sequence (401 amino acids)

>AZOBR_RS01705 murein transglycosylase (Azospirillum brasilense Sp245)
MFSLPVVRLSAAAVLAAAFLIGCERKEEEAKAPPPPPPEKLVLTPVAFTALPGWSADRVA
EAVPAFQRSCAKVRALAADRSIGPDGVGGKAADWQAPCAELAKLPPGDDAAARAYFETWF
TPYVAANNAERRGLFTGYYEVELKGSRTPDPAFPVPLYKRPADLVMVDLGEFADRWKGER
IAGRVTAGRLKPFEDRAAIEAGALSGKGLELVWLQDPIATFFLHIQGSGRVSFPDGTETR
VGYAAQNGHKYVAIGRELIDRGALKREEVSLQTIRAWLQANPGEAAALMNKNPSYVFFQE
LKGEGPNGAQNVALTPGRSLAVDSKFLPYGVPVWLDAEDPLDAQTRLRRLLIAQDTGGAI
RGPVRGDVFWGHGPEAEAKAGVMKSAGEYYVLLPKTVAPAS