Protein Info for AZOBR_RS01690 in Azospirillum brasilense Sp245

Updated annotation (from data): phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR03188.
Original annotation: phosphoribosyl-ATP pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03188: phosphoribosyl-ATP diphosphatase
  • amino acids 13 to 96 (84 residues), 112.2 bits, E=5.5e-37
• PF01503: PRA-PH
  • amino acids 14 to 99 (86 residues), 85.7 bits, E=1.1e-28

Best Hits

Swiss-Prot: 92% identical to HIS2_AZOBR: Phosphoribosyl-ATP pyrophosphatase (hisE) from Azospirillum brasilense

KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 81% identity to azl:AZL_028770)

Predicted SEED Role

"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.31

Sequence Analysis Tools

See G8AG52 at UniProt or InterPro

Protein Sequence (113 amino acids)

>AZOBR_RS01690 phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) (Azospirillum brasilense Sp245)
MSDDKAAATAEVLDRLYATVQARKGADPETSYTAKLFHRGTAKIAQKVGEEAVETVIEAV
RGDKAAVASESADLLYHLMVLWADAGLEPAAVWEKLAQREGTSGIAEKNARKA