Protein Info for AZOBR_RS01445 in Azospirillum brasilense Sp245

Annotation: S-adenosylmethionine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00438: S-AdoMet_synt_N
  • amino acids 5 to 104 (100 residues), 117.2 bits, E=6.2e-38
• TIGR01034: methionine adenosyltransferase
  • amino acids 7 to 387 (381 residues), 503.3 bits, E=2.1e-155
• PF02772: S-AdoMet_synt_M
  • amino acids 118 to 233 (116 residues), 143.3 bits, E=6.2e-46
• PF02773: S-AdoMet_synt_C
  • amino acids 235 to 377 (143 residues), 215.9 bits, E=2.9e-68

Best Hits

Swiss-Prot: 80% identical to METK_RHOCS: S-adenosylmethionine synthase (metK) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 89% identity to azl:AZL_028530)

MetaCyc: 56% identical to methionine adenosyltransferase (Escherichia coli K-12 substr. MG1655)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• S-adenosyl-L-methionine salvage II (3/3 steps found)
• S-adenosyl-L-methionine biosynthesis (1/1 steps found)
• L-methionine degradation I (to L-homocysteine) (2/3 steps found)
• S-adenosyl-L-methionine salvage I (2/4 steps found)
• L-methionine salvage cycle III (7/11 steps found)
• ethene biosynthesis I (plants) (1/3 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (2/5 steps found)
• 2'-deoxymugineic acid phytosiderophore biosynthesis (1/4 steps found)
• L-methionine salvage cycle I (bacteria and plants) (6/12 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (2/7 steps found)
• superpathway of L-methionine salvage and degradation (8/16 steps found)
• L-methionine salvage cycle II (plants) (4/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Sequence Analysis Tools

See G8AFZ8 at UniProt or InterPro

Protein Sequence (389 amino acids)

>AZOBR_RS01445 S-adenosylmethionine synthetase (Azospirillum brasilense Sp245)
VAKLNYVFTSESVSEGHPDKVCDRISDAIVDLYLSHDPYARVAVETLATTNQIVLAGEVR
GPESITPDMLVQVARAAVKDIGYEQDGFHWEKMDVKCFVHSQSADIAVGVDAAGEKDEGA
GDQGIMFGYACNETPALMPAPIYYSHAILKSLAEARHSGSAPQLGPDAKSQVTLQYENGK
PVRATAVVVSTQHADGLTQEEVREIVRPHVLNVLPAGWMCDEANFYVNPTGRFVIGGPDG
DAGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAAYAARYLAKNVVAAGLAERCTIQ
LSYAIGVSKPLSVYVDTHGTGTVDEDRLSEVLQKLVDLSPRGIRTHLGLNKPVYARTAAY
GHFGREAEADGGFSWEKTDLVNDLRAAFF