Protein Info for AZOBR_RS01290 in Azospirillum brasilense Sp245

Annotation: 2-octaprenylphenol hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01982: 2-polyprenylphenol 6-hydroxylase
  • amino acids 9 to 438 (430 residues), 568.2 bits, E=5e-175
• PF03109: ABC1
  • amino acids 90 to 334 (245 residues), 262.2 bits, E=1.9e-82

Best Hits

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 78% identity to azl:AZL_026030)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (7/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (4/8 steps found)
• superpathway of chorismate metabolism (40/59 steps found)

Sequence Analysis Tools

See G8AFF0 at UniProt or InterPro

Protein Sequence (512 amino acids)

>AZOBR_RS01290 2-octaprenylphenol hydroxylase (Azospirillum brasilense Sp245)
LFRTARNIGRLFVIGRTLARYNALPETLPQTAPGFALFWRWVGNAKEPGRVGQRLARALA
DLGPTYIKLGQLLSTRSDLVGERMALDLAELQDKLPPFPGAQARAIVEEELGAPIGTLFR
SFDEVPVAAASIAQVHFAVTAEGREVAVKVLRPGIENAFERDIDLFYWLAELAVMVMPKL
KRLRPREVVDTFARTSRLEMELRMEAAAASELGDNFKDDPTFNVPAIDWDRTARRVLTLE
RIRGFKVDESERLDAAGYDRDEILAKASASFFNQVFRDGFFHADLHPGNLFVTQDGNITA
VDFGIMGRLDRATRTYLADMLIGFLTGDYRRVAVVHFEAGYVPRHQSIEVFTQACRAIGE
PLQNKPLSEISVGRLLAQLFAVTEQFEMETQPQLLLLQKSMLTAEGVGRILNPDINMWEL
ARPLIEDWMRENRGPEAQILDDLEAVVSTVRRLPRLVNQAERAAAELADGGLRLHPHSIK
HMLDRWVERRISERVALWIIVVLLTVIAVRVL