Protein Info for AZOBR_RS01285 in Azospirillum brasilense Sp245

Annotation: ubiquinone biosynthesis methyltransferase UbiE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01209: Ubie_methyltran
  • amino acids 19 to 247 (229 residues), 266.3 bits, E=5.1e-83
• TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase
  • amino acids 24 to 246 (223 residues), 259.5 bits, E=1e-81
• PF13847: Methyltransf_31
  • amino acids 62 to 169 (108 residues), 45.9 bits, E=1.4e-15
• PF13649: Methyltransf_25
  • amino acids 67 to 161 (95 residues), 64.6 bits, E=2.8e-21
• PF08242: Methyltransf_12
  • amino acids 67 to 163 (97 residues), 41.4 bits, E=5.1e-14
• PF08241: Methyltransf_11
  • amino acids 67 to 165 (99 residues), 64.9 bits, E=2.2e-21

Best Hits

Swiss-Prot: 58% identical to UBIE_DINSH: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 84% identity to azl:AZL_026020)

MetaCyc: 57% identical to 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (Cereibacter sphaeroides)
RXN-9235 [EC: 2.1.1.201]

Predicted SEED Role

No annotation

MetaCyc Pathways

• menaquinol-4 biosynthesis I (1/1 steps found)
• menaquinol-6 biosynthesis (1/1 steps found)
• menaquinol-8 biosynthesis (1/1 steps found)
• menaquinol-9 biosynthesis (1/1 steps found)
• menaquinol-10 biosynthesis (1/2 steps found)
• menaquinol-11 biosynthesis (1/2 steps found)
• menaquinol-12 biosynthesis (1/2 steps found)
• menaquinol-13 biosynthesis (1/2 steps found)
• menaquinol-7 biosynthesis (1/2 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (7/12 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (4/8 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (4/8 steps found)
• superpathway of chorismate metabolism (40/59 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (3/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (3/8 steps found)
• superpathway of menaquinol-8 biosynthesis I (4/10 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (3/9 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of menaquinol-10 biosynthesis (3/10 steps found)
• superpathway of menaquinol-11 biosynthesis (3/10 steps found)
• superpathway of menaquinol-12 biosynthesis (3/10 steps found)
• superpathway of menaquinol-13 biosynthesis (3/10 steps found)
• superpathway of menaquinol-6 biosynthesis (3/10 steps found)
• superpathway of menaquinol-7 biosynthesis (3/10 steps found)
• superpathway of menaquinol-9 biosynthesis (3/10 steps found)
• superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)
• superpathway of menaquinol-8 biosynthesis II (2/10 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201

Sequence Analysis Tools

See G8AFE9 at UniProt or InterPro

Protein Sequence (248 amino acids)

>AZOBR_RS01285 ubiquinone biosynthesis methyltransferase UbiE (Azospirillum brasilense Sp245)
VSAGAEGNWFGYRPVDPDAKSGLVRAVFDSVAGRYDLMNDLMSGGIHRLWKDTLMEMVAP
RADMTLLDVAGGTGDIAFRFLERGGGRAVVCDITESMVRVGRDRSYDRNLLTGVNWTVGD
AERLPIASRSVDAYTIAFGLRNVTRIDAALSEARRVLKPGGKFFCLEFSHVVLPVLREIY
DVYSFQVLPRLGRMVAGDEDSYRYLAESIRRFPEQQAMVKRIEAAGFGAVRVRNLTGGIA
AIHSGWRI