Protein Info for AZOBR_RS01165 in Azospirillum brasilense Sp245

Annotation: cytochrome CBB3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details TIGR00782: cytochrome c oxidase, cbb3-type, subunit III" amino acids 7 to 294 (288 residues), 332.8 bits, see alignment E=8.6e-104 PF14715: FixP_N" amino acids 11 to 57 (47 residues), 84.6 bits, see alignment 4.5e-28 PF13442: Cytochrome_CBB3" amino acids 110 to 196 (87 residues), 39.2 bits, see alignment E=1.1e-13 amino acids 207 to 288 (82 residues), 57 bits, see alignment E=3.1e-19 PF00034: Cytochrom_C" amino acids 113 to 199 (87 residues), 55 bits, see alignment E=2.6e-18 amino acids 209 to 291 (83 residues), 33.9 bits, see alignment E=1e-11

Best Hits

Swiss-Prot: 97% identical to CCOP_AZOBR: Cbb3-type cytochrome c oxidase subunit CcoP (ccoP) from Azospirillum brasilense

KEGG orthology group: K00406, cb-type cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 83% identity to azl:AZL_003380)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoP (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AFC0 at UniProt or InterPro

Protein Sequence (295 amino acids)

>AZOBR_RS01165 cytochrome CBB3 (Azospirillum brasilense Sp245)
MAQKEKDALSGVETTGHEWDGLRELNNPLPKWWLYIFYVCIAWSLVYYVLYPAWPLGKSY
TKGLLGYSQREELVQKVADGKKAQEKYLTAIAATSVEDIQKNKDLLAFAMAGGRSYFNEN
CAACHGAGGQGAKGFPTLADDVWLWGGTSADIYKTIQHGIRADDGDTRGTVGIGMTAFGR
DGILNREQIGQVAEYVLSLNKRSTDAAAAEKGKTVYEENCAACHGDSAQGSVAVGMDVGA
PPLVTANWLYGGDKATLVETITNGRAGVMPAWSKRLDDATIKSLAVYVHNLGGGK