Protein Info for AZOBR_RS00785 in Azospirillum brasilense Sp245

Annotation: argininosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 TIGR00032: argininosuccinate synthase" amino acids 11 to 401 (391 residues), 471.7 bits, see alignment E=1.2e-145 PF00764: Arginosuc_synth" amino acids 11 to 174 (164 residues), 215.6 bits, see alignment E=4.3e-68 PF20979: Arginosuc_syn_C" amino acids 185 to 401 (217 residues), 274 bits, see alignment E=9.1e-86

Best Hits

Swiss-Prot: 86% identical to ASSY_RHOCS: Argininosuccinate synthase (argG) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 95% identity to azl:AZL_002110)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AF27 at UniProt or InterPro

Protein Sequence (411 amino acids)

>AZOBR_RS00785 argininosuccinate synthase (Azospirillum brasilense Sp245)
MSGASGKQIKKVVLAYSGGLDTSVILKWLQETYQCEVVTFTADLGQGEELEPARKKAELL
GIKPENIFIDDLREEFVRDFVFPMFRANTLYEGTYLLGTSIARPLIAKRQIEIANQVGAD
AVAHGATGKGNDQVRFELGYYALRPDIKIIAPWREWDLSSRTRLIDYAEKNQIPIAKDKR
GEAPYSTDANLLHISYEGKALEDPWVEPFEDMYTRSVAPEKAPDTPTYVEVEFKRGDAVA
IDGKALSPAALLTELNRLGGENGIGRLDLVENRYVGMKSRGVYETPGGTILLAAHRAMES
ITLDRGAGHLKDELMPRYAELIYCGYWFSPERLALQALIDQTQEPVNGVVRLKLFKGNVT
VVGRKSPNSLYRMDYVTFEEDSVYNQKDAEGFIKLNALRLRLGAMARANVK