Protein Info for AZOBR_RS00785 in Azospirillum brasilense Sp245

Annotation: argininosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00032: argininosuccinate synthase
  • amino acids 11 to 401 (391 residues), 471.7 bits, E=1.2e-145
• PF00764: Arginosuc_synth
  • amino acids 11 to 174 (164 residues), 215.6 bits, E=4.3e-68
• PF20979: Arginosuc_syn_C
  • amino acids 185 to 401 (217 residues), 274 bits, E=9.1e-86

Best Hits

Swiss-Prot: 86% identical to ASSY_RHOCS: Argininosuccinate synthase (argG) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 95% identity to azl:AZL_002110)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (17/17 steps found)
• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• urea cycle (4/5 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• canavanine biosynthesis (2/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

See G8AF27 at UniProt or InterPro

Protein Sequence (411 amino acids)

>AZOBR_RS00785 argininosuccinate synthase (Azospirillum brasilense Sp245)
MSGASGKQIKKVVLAYSGGLDTSVILKWLQETYQCEVVTFTADLGQGEELEPARKKAELL
GIKPENIFIDDLREEFVRDFVFPMFRANTLYEGTYLLGTSIARPLIAKRQIEIANQVGAD
AVAHGATGKGNDQVRFELGYYALRPDIKIIAPWREWDLSSRTRLIDYAEKNQIPIAKDKR
GEAPYSTDANLLHISYEGKALEDPWVEPFEDMYTRSVAPEKAPDTPTYVEVEFKRGDAVA
IDGKALSPAALLTELNRLGGENGIGRLDLVENRYVGMKSRGVYETPGGTILLAAHRAMES
ITLDRGAGHLKDELMPRYAELIYCGYWFSPERLALQALIDQTQEPVNGVVRLKLFKGNVT
VVGRKSPNSLYRMDYVTFEEDSVYNQKDAEGFIKLNALRLRLGAMARANVK