Protein Info for AZOBR_RS00645 in Azospirillum brasilense Sp245

Annotation: magnesium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 268 to 291 (24 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details PF01544: CorA" amino acids 27 to 325 (299 residues), 171.8 bits, see alignment E=1.1e-54

Best Hits

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 82% identity to azl:AZL_026920)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AEI7 at UniProt or InterPro

Protein Sequence (329 amino acids)

>AZOBR_RS00645 magnesium transporter (Azospirillum brasilense Sp245)
MITVHARVGGRVVEQPLALGESLPPNTVWIDLLRPDEAERAHVGAVTGCDLPTREEMKEI
EASSQLYTEGEAVYLTSSVIARADSPMPEQGEVTFVLTPRHMITVRFTEPRSVATFAVRT
SRQPELLASAEDALLGILDAVIDRVADVLELIGARIDGLSTRIFTDSLNSKGVGSSKKPD
ELQDVLRGIGRAGDLTHKVRDSLAGLDRLVAFLSSVAAGRLTKEQKAALKTLTRDLRSLN
EHAGFLAHEANFLLDATLGLINIEQNAIIKIFSVVSVALMPPTLIASAYGMNFHHMPELD
WDFGYPMAIVMMVLSAVVPLWYFRRRGWL