Protein Info for AZOBR_RS00475 in Azospirillum brasilense Sp245

Annotation: putative Integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 98 to 115 (18 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details PF00892: EamA" amino acids 37 to 165 (129 residues), 30.1 bits, see alignment E=2.5e-11 amino acids 176 to 299 (124 residues), 31.2 bits, see alignment E=1.2e-11

Best Hits

KEGG orthology group: None (inferred from 34% identity to axy:AXYL_03302)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AEE8 at UniProt or InterPro

Protein Sequence (310 amino acids)

>AZOBR_RS00475 putative Integral membrane protein (Azospirillum brasilense Sp245)
LSVPPAERTVLPVPTGAKRLTVSEGAERRSGIAGAALLMAASLALVLTAGALARELGARY
GAAEVLFLRFLLSLPVVAAAAFAMAGRRALSVTRPGGHAVRALSGVGAALIFYAAAQHLP
FADLVALSYAAPLFVVLLSGPAIGERAGAASAVCVALGMAGVFLIAPPTRLEPWSLAMLA
MAFLNAVCILATRRTAQADGPAATGLVFVLAGCLLTAPAALLTDFQMPEPADLPVFLLLG
FAAGAAILLNAAAFRRAPAAVLAPIDYLGIAASAAIGFLWWGESPSPAVLLGGGLIAAAG
LGTLWAGARR