Protein Info for AZOBR_RS00325 in Azospirillum brasilense Sp245

Annotation: glycerol-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03807: F420_oxidored
  • amino acids 8 to 105 (98 residues), 28.2 bits, E=7e-10
• PF03446: NAD_binding_2
  • amino acids 8 to 117 (110 residues), 21.9 bits, E=4.8e-08
• PF02558: ApbA
  • amino acids 9 to 115 (107 residues), 30.2 bits, E=1e-10
• PF01210: NAD_Gly3P_dh_N
  • amino acids 9 to 162 (154 residues), 160.2 bits, E=1.3e-50
• PF07479: NAD_Gly3P_dh_C
  • amino acids 183 to 318 (136 residues), 170.3 bits, E=8.7e-54
• PF20618: GPD_NAD_C_bact
  • amino acids 243 to 309 (67 residues), 66.4 bits, E=8.1e-22

Best Hits

Swiss-Prot: 60% identical to GPDA_PARL1: Glycerol-3-phosphate dehydrogenase [NAD(P)+] (gpsA) from Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 82% identity to azl:AZL_004060)

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• phosphatidylglycerol biosynthesis I (5/6 steps found)
• phosphatidylglycerol biosynthesis II (5/6 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• CDP-diacylglycerol biosynthesis III (3/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (8/12 steps found)
• 1,3-propanediol biosynthesis (engineered) (5/9 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (6/13 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Sequence Analysis Tools

See G8AEB4 at UniProt or InterPro

Protein Sequence (336 amino acids)

>AZOBR_RS00325 glycerol-3-phosphate dehydrogenase (Azospirillum brasilense Sp245)
MAATDFRRIGVIGGGAWGTALALAALRAGREALLWAREPAVVESVNTARENRDYLPGVTL
PAALRATGDLAEAAACDAILLVTPAQHLRSACAGLAAHLRTGTPLVICAKGIELDSHALM
SEAAAAALPAGTPLAVLSGPTFAAEVARGLPTAVTLACADAALGARLVEALGSRTFRPYL
SDDVVGSQIGGAVKNVLAIACGVVEGRKLGDNARAALITRGLAEITRLALALGGRPETLM
GLSGLGDLTLTCSSLQSRNMSLGAALGAGRTLAEILAERRSVAEGVYTAAAVVGLAGRKG
VDMPLCAAVDAILNRGAGLDGTIDGLLSRPFREEGR