Protein Info for AO356_30395 in Pseudomonas fluorescens FW300-N2C3

Annotation: tricarballylate utilization protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 116 to 142 (27 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details amino acids 311 to 327 (17 residues), see Phobius details amino acids 333 to 354 (22 residues), see Phobius details TIGR02484: CitB domain protein" amino acids 20 to 377 (358 residues), 407.1 bits, see alignment E=3.9e-126

Best Hits

Swiss-Prot: 63% identical to CITB_ECOLX: Citrate utilization protein B (citB) from Escherichia coli

KEGG orthology group: K13795, citrate/tricarballylate utilization protein (inferred from 98% identity to pba:PSEBR_a2044)

Predicted SEED Role

"TcuB: works with TcuA to oxidize tricarballylate to cis-aconitate" in subsystem Tricarballylate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WQD4 at UniProt or InterPro

Protein Sequence (385 amino acids)

>AO356_30395 tricarballylate utilization protein B (Pseudomonas fluorescens FW300-N2C3)
MQLFDPQVSSQLIPVLNLQETEVGRQMTICNACRYCEGFCAVFPAMTRHLEFGQADIHYL
ANLCHNCGACLSACQYAAPHEFAVNVPKAMAKVRLETYTNYAWPQPLGKLYQRNGLTLAL
ASGAGLALFLSLTLMIMGNLFIAMPDGNFYKIFPHNTLALMFSAVFGFAVLALGIGVRRF
WREISPAEAPLPLKASAALEAGANVAQLKYLDGGHGEGCNNADDEFTLWRRRFHHLTFYG
FMLCFAATGVATLYHFLLDWSAPYPILSLPVLLGIFGGVGLLIGPAGLLWMNLRRNPQQG
DENQKPMDRGFIALLFLVSASGLALLAGRETSALGLLLAIHLGLVMAFFLTMPYSKFAHG
IFRSAALLKYTIEKRQPNPISAGGE