Protein Info for AO356_30195 in Pseudomonas fluorescens FW300-N2C3

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 5 to 199 (195 residues), 189.9 bits, E=5.3e-60
• PF08659: KR
  • amino acids 7 to 168 (162 residues), 69.3 bits, E=6.2e-23
• PF13561: adh_short_C2
  • amino acids 11 to 225 (215 residues), 128.3 bits, E=5.6e-41

Best Hits

Swiss-Prot: 70% identical to Y432_LISMO: Uncharacterized oxidoreductase Lmo0432 (lmo0432) from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a2080)

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• D-sorbitol degradation II (1/1 steps found)
• L-sorbose degradation (1/2 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.140

Sequence Analysis Tools

See A0A0N9X399 at UniProt or InterPro

Protein Sequence (247 amino acids)

>AO356_30195 oxidoreductase (Pseudomonas fluorescens FW300-N2C3)
MIKDKVVIITGASSGIGEATAKLLASKGAKIVLGARREDKLKQIADEILLNGGQVVYQAL
DVTKQEDNNSIVRLAKERFGRVDVIFLNAGLMPNSPLSALKTEDWHQMIDVNVKGVLNGV
AAVLPEFLAQKAGHVITTSSVAGLKAYPGGAVYGGTKWFVRDFMEVLRMESAMEGNNIRT
ATIYPAAVKTELLATISDKLALDQMQDIYDKYGISPDRIANIVAFAIDQPDDTTINEFTV
GPANQPW