Protein Info for AO356_29650 in Pseudomonas fluorescens FW300-N2C3

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 17 to 41 (25 residues), see Phobius details amino acids 49 to 73 (25 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 10 to 107 (98 residues), 99.1 bits, see alignment E=8.3e-33 PF00528: BPD_transp_1" amino acids 32 to 213 (182 residues), 69.1 bits, see alignment E=2.2e-23

Best Hits

Swiss-Prot: 46% identical to YECS_ECOLI: L-cystine transport system permease protein YecS (yecS) from Escherichia coli (strain K12)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 93% identity to pfl:PFL_2283)

MetaCyc: 46% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"ABC-type amino acid transport system, permease component"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WG61 at UniProt or InterPro

Protein Sequence (218 amino acids)

>AO356_29650 amino acid ABC transporter permease (Pseudomonas fluorescens FW300-N2C3)
MILQNALDFLPILLKGAVVTLQVTAGSFVLSSLIGLLLALMMVSKIRAVALFAISVVNII
RGLPIIVQLFYIYFVLPEFGIQLTAMQAGVIGLGIAYSAYQAENFRAGIQAIQQGQIEAA
ESLGMRGAMVMRRVVLPQAFRIALPPYGNTLVMMLKDSSLVSTITVAEMTRAGQLIASST
FENMTVYTLVALLYLAMSLPLSFALRRLEARFSTRRTS