Protein Info for AO356_29235 in Pseudomonas fluorescens FW300-N2C3

Annotation: acyl-CoA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 27 to 402 (376 residues), 238.4 bits, E=1.2e-74
• PF13193: AMP-binding_C
  • amino acids 452 to 527 (76 residues), 76.3 bits, E=3e-25

Best Hits

Swiss-Prot: 46% identical to AAE4_ARATH: Probable acyl-activating enzyme 4 (AEE4) from Arabidopsis thaliana

KEGG orthology group: K00666, fatty-acyl-CoA synthase [EC: 6.2.1.-] (inferred from 75% identity to vpe:Varpa_3641)

MetaCyc: 50% identical to cinnamate:CoA ligase (Hypericum calycinum)
4-coumarate--CoA ligase. [EC: 6.2.1.12]; 6.2.1.- [EC: 6.2.1.12]

Predicted SEED Role

"3-methylmercaptopropionyl-CoA ligase (DmdB)"

MetaCyc Pathways

• 4-hydroxybenzoate biosynthesis III (plants) (4/5 steps found)
• umbelliferone biosynthesis (2/3 steps found)
• 5,6-dehydrokavain biosynthesis (engineered) (7/10 steps found)
• cinnamoyl-CoA biosynthesis (1/2 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (3/5 steps found)
• 6-gingerol analog biosynthesis (engineered) (3/6 steps found)
• 4-coumarate degradation (aerobic) (2/5 steps found)
• naringenin biosynthesis (engineered) (1/4 steps found)
• xanthohumol biosynthesis (1/4 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (4/9 steps found)
• chlorogenic acid biosynthesis II (1/5 steps found)
• flavonoid biosynthesis (1/5 steps found)
• phaselate biosynthesis (1/5 steps found)
• 4-coumarate degradation (anaerobic) (1/6 steps found)
• rosmarinic acid biosynthesis I (3/10 steps found)
• chlorogenic acid biosynthesis I (1/8 steps found)
• avenanthramide biosynthesis (1/9 steps found)
• superpathway of rosmarinic acid biosynthesis (4/14 steps found)
• curcuminoid biosynthesis (1/10 steps found)
• coumarins biosynthesis (engineered) (3/13 steps found)
• flavonoid di-C-glucosylation (3/15 steps found)
• monolignol biosynthesis (1/15 steps found)
• suberin monomers biosynthesis (3/20 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis II
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Caprolactam degradation
• Ethylbenzene degradation
• Geraniol degradation
• Limonene and pinene degradation
• Phenylpropanoid biosynthesis
• Propanoate metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.-

Use Curated BLAST to search for 6.2.1.- or 6.2.1.12

Sequence Analysis Tools

See A0A0N9X589 at UniProt or InterPro

Protein Sequence (550 amino acids)

>AO356_29235 acyl-CoA synthetase (Pseudomonas fluorescens FW300-N2C3)
MKPGAYENGLEQSKANYLPLTPLGFLDRAALVHPDRVAVVHGDLRRTWRQTRERCYRLAS
ALSNEGMGAGDTVSILSPNTPAMLEAHFGVPLCGAVLNTVNYRLDAEGVAFILRHGECKL
LLVDREFAALAVAALERLEHPPVVIDINDHLAPLGSSIGDVDYETFIGRGSPDFQGVWPS
DEWQPIALNYTSGTTGDPKGVVASHRGTYLMSMLQMTNWPLSRAPRYLWTLPMFHANGWC
FTWAITAAAGTHVCLRKVSAEAVFDAIDTQGVDHFCAAPIVMAMIANSADRPPLETPVRV
LTAGSPPPATVLDAVVSLGFDVDHVYGITEVSGTPISCVWQDGWNALAQSDQGALRVRQG
ARAAGFEGLMVADADTLQPVPKDGHTTGELLLKGNTVMMGYLKNENATRKAFEGGWFHTG
DVAVVHPNGYIQITDRCKDVIISGGENISSVEIEEAIHCHPAVLHAAVVAQPDDIWGEVP
CAFIELKGGAERPTEADMIAFCQARLARFKCPRRVIFMELPKTATGKIQKFLLREQAGSR
DAIVRLASSG