Protein Info for AO356_28495 in Pseudomonas fluorescens FW300-N2C3

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF13377: Peripla_BP_3" amino acids 115 to 272 (158 residues), 123.1 bits, see alignment E=2.7e-39 PF12833: HTH_18" amino acids 310 to 388 (79 residues), 70.4 bits, see alignment E=2.7e-23 PF00165: HTH_AraC" amino acids 351 to 388 (38 residues), 45.6 bits, see alignment 1.1e-15

Best Hits

Swiss-Prot: 47% identical to XYLR_ECOLI: Xylose operon regulatory protein (xylR) from Escherichia coli (strain K12)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 98% identity to pba:PSEBR_a2598)

Predicted SEED Role

"Xylose activator XylR (AraC family)" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WFN2 at UniProt or InterPro

Protein Sequence (395 amino acids)

>AO356_28495 AraC family transcriptional regulator (Pseudomonas fluorescens FW300-N2C3)
MKTVPPVHRIALLFNGSKIYDRGIISGIGNYLSSTRASWDLFLEEDFLCRLKGIERWQGD
GIIADFDDPLIGEALAGIKLPVVAVGGSYQDERAYPKGIPYVATDNDALMRLAYEHLIEA
GLTRFACFSLPEAQANRWAQEREKAFRRLVQRDGLPAEVYRGMGTSAPLWDSAVEQQIAW
LQSLPKPIGIIAVSDARARQLLQACLTAGIAVPEQVALIGIDNDPLTRSLTRVPLSSVIQ
GTETMGRTAARLLHQMLHGMPSTGTQILIPPDAINVQVSSLHQPLGNPYVMQALLFIRQY
ACQGIKTAQVAAYVGISRSSLEAHFRKERGCSVHDEILRFKLTAAANGLENTDAPIADIA
QNCGFKSAQYLHTVFRREFGCTPREYQQGASAGTQ