Protein Info for AO356_28385 in Pseudomonas fluorescens FW300-N2C3

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 166 to 182 (17 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 220 to 247 (28 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 279 (271 residues), 109.1 bits, see alignment E=1.1e-35

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 99% identity to pba:PSEBR_a2618)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H352 at UniProt or InterPro

Protein Sequence (293 amino acids)

>AO356_28385 ABC transporter permease (Pseudomonas fluorescens FW300-N2C3)
MEFFFEVLIGGLLAGVMYALVAIGFVLIYKASGVFNFAQGAMVLFSALTFVSLLERGVPF
WLAFVISLAAMVLIAVAVERVVLRPLVNRSPITLFMATLGLSYVIEGFAQALWGAQVHGL
ELGISDEPLELGGMLLSQFDIFAAVTAAFLVLLLSWLFNKTRLGLSLRAVADDPLAALAV
GIRLQRVWVVVWAVAGFVGLVAGLLWGARLGVQFSLSLVVLKALPVLIIGGFTSISGAIV
GGLIIGASEKLAEVYLGPFIGSGIENWFPYVLALLFLLVRPAGLFGERAIERV