Protein Info for AO356_27670 in Pseudomonas fluorescens FW300-N2C3

Annotation: sugar ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01547: SBP_bac_1" amino acids 39 to 327 (289 residues), 210.7 bits, see alignment E=5.1e-66 PF13416: SBP_bac_8" amino acids 42 to 353 (312 residues), 105.5 bits, see alignment E=4.4e-34

Best Hits

KEGG orthology group: K10227, sorbitol/mannitol transport system substrate-binding protein (inferred from 99% identity to pba:PSEBR_a3086)

MetaCyc: 85% identical to polyol ABC-type transporter periplasmic substrate-binding protein (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, periplasmic substrate-binding protein" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WF98 at UniProt or InterPro

Protein Sequence (436 amino acids)

>AO356_27670 sugar ABC transporter substrate-binding protein (Pseudomonas fluorescens FW300-N2C3)
MKPSVKALLVSTCMTLSSVSFGAQTLTIATVNNSDMIRMQKLSKTFEAEHPDIKLNWVVL
EENVLRQRLTTDIATQGGQFDVLTIGMYEAALWGAKGWLEPMKDLPASYDLDDVFPSVRD
GLSVKGSLYALPFYAESSITYYRTDLFKNAGLTMPEHPTWTQIGEFAEKLTDKSKEQYGL
CLRGKAGWGENMALITTLANGYGARWFDEKWQPQFNGPEWKDALNFYVDNMKKSGPPGAS
SNGFNENLALFNSGKCAIWVDASVAGSFVTDKTQSKVSDHVGFTFAPHEKTDKGTSWMYS
WSLAIPTSSKAKEAATVFTTWATSKEYSQLVAKTDGIANVPPGTRTSTYSDEYMKAAPFA
KVTLESLKVADPKAPTLKPVPYIGIQLVTIPEFQAIGTQVGKFFSGALTGQQTVDQALTA
AQSTTEREMKRAGYPK