Protein Info for AO356_27545 in Pseudomonas fluorescens FW300-N2C3

Annotation: peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 255 to 264 (10 residues), see Phobius details amino acids 271 to 279 (9 residues), see Phobius details TIGR01842: type I secretion system ATPase" amino acids 13 to 556 (544 residues), 754.7 bits, see alignment E=2.7e-231 PF00664: ABC_membrane" amino acids 23 to 278 (256 residues), 50.7 bits, see alignment E=2.2e-17 PF00005: ABC_tran" amino acids 348 to 493 (146 residues), 103.6 bits, see alignment E=1.5e-33

Best Hits

Swiss-Prot: 55% identical to APRD_PSEAE: Alkaline protease secretion ATP-binding protein AprD (aprD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 72% identity to pmy:Pmen_0720)

Predicted SEED Role

"ABC-type protease/lipase transport system, ATPase and permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WPE3 at UniProt or InterPro

Protein Sequence (571 amino acids)

>AO356_27545 peptidase (Pseudomonas fluorescens FW300-N2C3)
MSAHVRTELEGALAVCKGSFLSVGFFSFFVNLLMLVPSFYMLQVYDRAVGSASLSTLLML
TLIMLLLMITMGGLEWVRSRIMVRISTRLDTLLSRRLFDASFKQALNTSGMNATAQPLSD
LNGLRQFLTGNGLFAFFDAPWIPIYLAVMFMFHSWYGWMGIVSAVLLGALAFANEKLTHS
PLQAANREQMAATAFTNKSLRNAEVVESMGMLASLREHWSGRTHKILALQSLASDRAATI
TSVSRTFRQIVQSLVLGLGAYLTINHEISSGLMIAGSILLGRALAPIDQLIGVWKGFLGA
RAQYARLHELLLKIAAEPERMPLPAPEGAIRVEGLSAGSPDARKPIIRGVDFQVAAGEVV
GIIGPSGAGKSTLARALLGVWPSLVGTVRLDGADISQWRREELGQYIGYLPQDIELFEGT
ISQNISRFGPVNAPAVVAAASMAGVHELILQLPDGYDTLIGANGGGLSGGQRQRIGLARA
LYGEPRLVVLDEPNSNLDDAGEKMLAEALQKLRQSRATVFVITHRSGVLAQVDKLLVLNH
GELSLFGPRDQVLARLRDVTPTTRQAAAIQP