Protein Info for AO356_27025 in Pseudomonas fluorescens FW300-N2C3

Annotation: peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 60 to 84 (25 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 252 to 282 (31 residues), see Phobius details TIGR01842: type I secretion system ATPase" amino acids 18 to 558 (541 residues), 771.5 bits, see alignment E=2.3e-236 PF00664: ABC_membrane" amino acids 26 to 283 (258 residues), 46 bits, see alignment E=5.7e-16 PF00005: ABC_tran" amino acids 349 to 495 (147 residues), 107.5 bits, see alignment E=8.7e-35

Best Hits

Swiss-Prot: 58% identical to APRD_PSEAE: Alkaline protease secretion ATP-binding protein AprD (aprD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K12536, ATP-binding cassette, subfamily C, bacterial HasD (inferred from 93% identity to pba:PSEBR_a2823)

Predicted SEED Role

"ABC-type protease exporter, ATP-binding component PrtD/AprD" in subsystem Protein secretion by ABC-type exporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X3Y9 at UniProt or InterPro

Protein Sequence (592 amino acids)

>AO356_27025 peptidase (Pseudomonas fluorescens FW300-N2C3)
MNKARSAASAPLFKALGDYKSILISVGCFTALINVLMLAPSIYMLQVYDRGLSSQNETTL
VMLSLMVVGFFVFIGLLEMVRSFVVIRIGSQLERRFNLQVYRAAFERNLRQGEGNAGQSL
GDLTHIRQFLTGPALFAFFDAPWFPVYLLVIYLFNVWLGVFASVGTLLLIGLACLNEAMT
KKALGQASVYSQQSSQLATSHLHNAETIQAMGMLAALRGRWFAVHSRFLGLQNQASDTGA
VISSLSKTLRLCLQSLVLGLGALLVIKGDMTAGMMIAGSILMGRVLSPIDQLIAVWKQWS
GAKLAYRRLDVLLQAFAPQDDGMTLPAPKGQVSFEQVSAGPPGQRNATLQQVSFSLAAGD
VLGVLGASGSGKSTLARVLVGVWPTLAGTVRLDGADIHRWNRDQLGPHIGYLPQDIELFS
GSIAENIARFRDADPQKVVAAAQQAGVHELILRLPQGYDTVLGEDGGGLSGGQKQRVALA
RAMYDRPSLVVLDEPNSNLDTVGEAALAGAIAQMKAQGTSVVLVTHRSSALAQADKLLVL
NEGRLQAFGPSQEVLRALSGQSETPQRDRPQATPNGLSMSRQYQAASKPGGA