Protein Info for AO356_27015 in Pseudomonas fluorescens FW300-N2C3

Annotation: peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02321: OEP" amino acids 25 to 216 (192 residues), 71.7 bits, see alignment E=3.7e-24 amino acids 242 to 428 (187 residues), 101.3 bits, see alignment E=3e-33 TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 27 to 442 (416 residues), 386.3 bits, see alignment E=9.3e-120

Best Hits

Swiss-Prot: 55% identical to APRF_PSEAE: Alkaline protease secretion protein AprF (aprF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a2825)

Predicted SEED Role

"ABC-type protease exporter, outer membrane component PrtF/AprF" in subsystem Protein secretion by ABC-type exporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WEZ0 at UniProt or InterPro

Protein Sequence (449 amino acids)

>AO356_27015 peptidase (Pseudomonas fluorescens FW300-N2C3)
MKRFYWMAVLAVSVCGNAWAMGPFEFYEQALRNDPIYLGAIKERDAGLENRAIGRAGLLP
HLGYSYNKGRNQSKVTYLNDRGASQHDDRNYSSYGSSLTLQQPLLDYEAYAAYRKGVAQA
LFADESFRDKSQALLVRVLSQYTQALFAQDQIDIAQAKKKAFEQQFQQNEQLFRQGEGTR
TDILEAQARYELAIAEEIEARDEQDAALRELGSLIGVPALDIGDLAPLHDTFQTFALQPA
SFDTWHELAVSNNPSLASQRQAVDVARFEVERNRAGHLPKVSAYATMRQNESESGNTYNQ
RYDTNTIGLEVSVPLYAGGGVSASTRQASRNMEQAEYELEAKTRETLIELRRQFSACVSG
MNKLRAYQKALSSAEALVVSTRQSILGGERVNLDALNAEQQLYTTRRDLAQARYDYLMAW
TKLHYYAGTLGPQDLAKVDEAFVSRAPIQ